Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups


  1. Avatar for Go Science 100 pts. 10,148
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,013
  3. Avatar for Marvin's bunch 3. Marvin's bunch 60 pts. 10,011
  4. Avatar for Beta Folders 4. Beta Folders 45 pts. 9,982
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,879
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,841
  7. Avatar for Deleted group 7. Deleted group pts. 9,668
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,652
  9. Avatar for Contenders 9. Contenders 8 pts. 9,644
  10. Avatar for Deleted group 10. Deleted group pts. 9,416

  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 37 pts. 9,531
  2. Avatar for crpainter 32. crpainter Lv 1 36 pts. 9,521
  3. Avatar for guineapig 33. guineapig Lv 1 35 pts. 9,514
  4. Avatar for katling 34. katling Lv 1 34 pts. 9,513
  5. Avatar for diamonddays 35. diamonddays Lv 1 32 pts. 9,509
  6. Avatar for anthion 36. anthion Lv 1 31 pts. 9,506
  7. Avatar for johnmitch 37. johnmitch Lv 1 30 pts. 9,474
  8. Avatar for Bobnine 38. Bobnine Lv 1 29 pts. 9,463
  9. Avatar for YGK 39. YGK Lv 1 28 pts. 9,460
  10. Avatar for gurch 40. gurch Lv 1 27 pts. 9,440

Comments


Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!