Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups


  1. Avatar for Russian team 11. Russian team 4 pts. 9,237
  2. Avatar for freefolder 12. freefolder 2 pts. 9,157
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 8,729
  4. Avatar for GENE 433 14. GENE 433 1 pt. 8,728
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,626
  6. Avatar for xkcd 16. xkcd 1 pt. 8,619
  7. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,839
  8. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 7,097
  9. Avatar for EricHamber 20. EricHamber 1 pt. 6,211

  1. Avatar for WBarme1234 41. WBarme1234 Lv 1 26 pts. 9,431
  2. Avatar for manu8170 42. manu8170 Lv 1 25 pts. 9,419
  3. Avatar for drumpeter18yrs9yrs 43. drumpeter18yrs9yrs Lv 1 24 pts. 9,416
  4. Avatar for dcrwheeler 44. dcrwheeler Lv 1 23 pts. 9,402
  5. Avatar for smilingone 45. smilingone Lv 1 22 pts. 9,394
  6. Avatar for Blipperman 46. Blipperman Lv 1 21 pts. 9,382
  7. Avatar for Glen B 47. Glen B Lv 1 20 pts. 9,381
  8. Avatar for weitzen 48. weitzen Lv 1 19 pts. 9,380
  9. Avatar for Bautho 49. Bautho Lv 1 19 pts. 9,374
  10. Avatar for yoyoparis 50. yoyoparis Lv 1 18 pts. 9,360

Comments


Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!