Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,148
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,013
  3. Avatar for Marvin's bunch 3. Marvin's bunch 60 pts. 10,011
  4. Avatar for Beta Folders 4. Beta Folders 45 pts. 9,982
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,879
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,841
  7. Avatar for Deleted group 7. Deleted group pts. 9,668
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,652
  9. Avatar for Contenders 9. Contenders 8 pts. 9,644
  10. Avatar for Deleted group 10. Deleted group pts. 9,416
  1. Avatar for WBarme1234 41. WBarme1234 Lv 1 26 pts. 9,431
  2. Avatar for manu8170 42. manu8170 Lv 1 25 pts. 9,419
  3. Avatar for drumpeter18yrs9yrs 43. drumpeter18yrs9yrs Lv 1 24 pts. 9,416
  4. Avatar for dcrwheeler 44. dcrwheeler Lv 1 23 pts. 9,402
  5. Avatar for smilingone 45. smilingone Lv 1 22 pts. 9,394
  6. Avatar for Blipperman 46. Blipperman Lv 1 21 pts. 9,382
  7. Avatar for Glen B 47. Glen B Lv 1 20 pts. 9,381
  8. Avatar for weitzen 48. weitzen Lv 1 19 pts. 9,380
  9. Avatar for Bautho 49. Bautho Lv 1 19 pts. 9,374
  10. Avatar for yoyoparis 50. yoyoparis Lv 1 18 pts. 9,360

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!