Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for BaconSBI4U septembre 2017 21. BaconSBI4U septembre 2017 1 pt. 4,380
  1. Avatar for Deleted player 111. Deleted player pts. 8,295
  2. Avatar for leannerikicheever 112. leannerikicheever Lv 1 1 pt. 8,282
  3. Avatar for Ricardo Oliveira 113. Ricardo Oliveira Lv 1 1 pt. 8,265
  4. Avatar for Superphosphate 114. Superphosphate Lv 1 1 pt. 8,246
  5. Avatar for rinze 115. rinze Lv 1 1 pt. 8,215
  6. Avatar for leehaggis 116. leehaggis Lv 1 1 pt. 8,192
  7. Avatar for nellasdim 117. nellasdim Lv 1 1 pt. 8,177
  8. Avatar for LicketySplit1492 118. LicketySplit1492 Lv 1 1 pt. 8,118
  9. Avatar for xabxs 119. xabxs Lv 1 1 pt. 8,103
  10. Avatar for SWR_DMaster 120. SWR_DMaster Lv 1 1 pt. 8,080

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!