Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,148
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,013
  3. Avatar for Marvin's bunch 3. Marvin's bunch 60 pts. 10,011
  4. Avatar for Beta Folders 4. Beta Folders 45 pts. 9,982
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,879
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,841
  7. Avatar for Deleted group 7. Deleted group pts. 9,668
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,652
  9. Avatar for Contenders 9. Contenders 8 pts. 9,644
  10. Avatar for Deleted group 10. Deleted group pts. 9,416
  1. Avatar for Deleted player 111. Deleted player pts. 8,295
  2. Avatar for leannerikicheever 112. leannerikicheever Lv 1 1 pt. 8,282
  3. Avatar for Ricardo Oliveira 113. Ricardo Oliveira Lv 1 1 pt. 8,265
  4. Avatar for Superphosphate 114. Superphosphate Lv 1 1 pt. 8,246
  5. Avatar for rinze 115. rinze Lv 1 1 pt. 8,215
  6. Avatar for leehaggis 116. leehaggis Lv 1 1 pt. 8,192
  7. Avatar for nellasdim 117. nellasdim Lv 1 1 pt. 8,177
  8. Avatar for LicketySplit1492 118. LicketySplit1492 Lv 1 1 pt. 8,118
  9. Avatar for xabxs 119. xabxs Lv 1 1 pt. 8,103
  10. Avatar for SWR_DMaster 120. SWR_DMaster Lv 1 1 pt. 8,080

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!