Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for BaconSBI4U septembre 2017 21. BaconSBI4U septembre 2017 1 pt. 4,380
  1. Avatar for tarimo 61. tarimo Lv 1 11 pts. 9,193
  2. Avatar for LavenderSky 62. LavenderSky Lv 1 11 pts. 9,179
  3. Avatar for alwen 63. alwen Lv 1 10 pts. 9,169
  4. Avatar for alcor29 64. alcor29 Lv 1 10 pts. 9,162
  5. Avatar for Altercomp 65. Altercomp Lv 1 9 pts. 9,157
  6. Avatar for fpc 66. fpc Lv 1 9 pts. 9,146
  7. Avatar for Deleted player 67. Deleted player pts. 9,132
  8. Avatar for Deleted player 68. Deleted player pts. 9,112
  9. Avatar for dizzywings 69. dizzywings Lv 1 8 pts. 9,106
  10. Avatar for Alistair69 70. Alistair69 Lv 1 7 pts. 9,098

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!