Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups


  1. Avatar for Go Science 100 pts. 10,148
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,013
  3. Avatar for Marvin's bunch 3. Marvin's bunch 60 pts. 10,011
  4. Avatar for Beta Folders 4. Beta Folders 45 pts. 9,982
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,879
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,841
  7. Avatar for Deleted group 7. Deleted group pts. 9,668
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,652
  9. Avatar for Contenders 9. Contenders 8 pts. 9,644
  10. Avatar for Deleted group 10. Deleted group pts. 9,416

  1. Avatar for tarimo 61. tarimo Lv 1 11 pts. 9,193
  2. Avatar for LavenderSky 62. LavenderSky Lv 1 11 pts. 9,179
  3. Avatar for alwen 63. alwen Lv 1 10 pts. 9,169
  4. Avatar for alcor29 64. alcor29 Lv 1 10 pts. 9,162
  5. Avatar for Altercomp 65. Altercomp Lv 1 9 pts. 9,157
  6. Avatar for fpc 66. fpc Lv 1 9 pts. 9,146
  7. Avatar for Deleted player 67. Deleted player pts. 9,132
  8. Avatar for Deleted player 68. Deleted player pts. 9,112
  9. Avatar for dizzywings 69. dizzywings Lv 1 8 pts. 9,106
  10. Avatar for Alistair69 70. Alistair69 Lv 1 7 pts. 9,098

Comments


Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!