Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,148
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,013
  3. Avatar for Marvin's bunch 3. Marvin's bunch 60 pts. 10,011
  4. Avatar for Beta Folders 4. Beta Folders 45 pts. 9,982
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,879
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,841
  7. Avatar for Deleted group 7. Deleted group pts. 9,668
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,652
  9. Avatar for Contenders 9. Contenders 8 pts. 9,644
  10. Avatar for Deleted group 10. Deleted group pts. 9,416
  1. Avatar for lamoille 141. lamoille Lv 1 1 pt. 6,119
  2. Avatar for Islid 142. Islid Lv 1 1 pt. 5,891
  3. Avatar for RNAguy16 143. RNAguy16 Lv 1 1 pt. 5,743
  4. Avatar for Rubiks_Of_Cristal 144. Rubiks_Of_Cristal Lv 1 1 pt. 5,716
  5. Avatar for karost 145. karost Lv 1 1 pt. 5,685
  6. Avatar for ozanertekin 146. ozanertekin Lv 1 1 pt. 5,534
  7. Avatar for BFitz15 147. BFitz15 Lv 1 1 pt. 5,215
  8. Avatar for NotJim99 148. NotJim99 Lv 1 1 pt. 5,152
  9. Avatar for vamistad 149. vamistad Lv 1 1 pt. 5,151
  10. Avatar for linqc1981 150. linqc1981 Lv 1 1 pt. 4,988

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!