Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups


  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,112
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,685
  3. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,904
  4. Avatar for Crunching Family 15. Crunching Family 1 pt. 7,884
  5. Avatar for EricHamber 16. EricHamber 1 pt. 4,768
  6. Avatar for Kentridge Biotech 17. Kentridge Biotech 1 pt. 4,757

  1. Avatar for LavenderSky 111. LavenderSky Lv 1 1 pt. 8,311
  2. Avatar for xabxs 112. xabxs Lv 1 1 pt. 8,306
  3. Avatar for MicElephant 113. MicElephant Lv 1 1 pt. 8,300
  4. Avatar for cinnamonkitty 114. cinnamonkitty Lv 1 1 pt. 8,278
  5. Avatar for eboppterp 115. eboppterp Lv 1 1 pt. 8,242
  6. Avatar for nellasdim 116. nellasdim Lv 1 1 pt. 8,219
  7. Avatar for rezaefar 117. rezaefar Lv 1 1 pt. 8,207
  8. Avatar for jburton83 118. jburton83 Lv 1 1 pt. 8,205
  9. Avatar for Ladybug_dk 119. Ladybug_dk Lv 1 1 pt. 8,194
  10. Avatar for Idiotboy 120. Idiotboy Lv 1 1 pt. 8,145

Comments