Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 9,976
  2. Avatar for Susume 2. Susume Lv 1 98 pts. 9,948
  3. Avatar for tokens 3. tokens Lv 1 95 pts. 9,945
  4. Avatar for fiendish_ghoul 4. fiendish_ghoul Lv 1 92 pts. 9,915
  5. Avatar for actiasluna 5. actiasluna Lv 1 89 pts. 9,897
  6. Avatar for Skippysk8s 6. Skippysk8s Lv 1 86 pts. 9,884
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 84 pts. 9,820
  8. Avatar for altejoh 8. altejoh Lv 1 81 pts. 9,813
  9. Avatar for frood66 9. frood66 Lv 1 78 pts. 9,801
  10. Avatar for tamanrasset 10. tamanrasset Lv 1 76 pts. 9,791

Comments