Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,112
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,685
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,502
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,904
  5. Avatar for Crunching Family 15. Crunching Family 1 pt. 7,884
  6. Avatar for EricHamber 16. EricHamber 1 pt. 4,768
  7. Avatar for Kentridge Biotech 17. Kentridge Biotech 1 pt. 4,757
  1. Avatar for nicobul 41. nicobul Lv 1 25 pts. 9,406
  2. Avatar for Mike Cassidy 42. Mike Cassidy Lv 1 24 pts. 9,389
  3. Avatar for diamonddays 43. diamonddays Lv 1 24 pts. 9,373
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 23 pts. 9,373
  5. Avatar for isaksson 45. isaksson Lv 1 22 pts. 9,353
  6. Avatar for Tehnologik1 46. Tehnologik1 Lv 1 21 pts. 9,338
  7. Avatar for pvc78 47. pvc78 Lv 1 20 pts. 9,297
  8. Avatar for jausmh 48. jausmh Lv 1 19 pts. 9,283
  9. Avatar for andrewxc 49. andrewxc Lv 1 18 pts. 9,280
  10. Avatar for drumpeter18yrs9yrs 50. drumpeter18yrs9yrs Lv 1 18 pts. 9,275

Comments