Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,112
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,685
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,502
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,904
  5. Avatar for Crunching Family 15. Crunching Family 1 pt. 7,884
  6. Avatar for EricHamber 16. EricHamber 1 pt. 4,768
  7. Avatar for Kentridge Biotech 17. Kentridge Biotech 1 pt. 4,757
  1. Avatar for Cagdason 61. Cagdason Lv 1 11 pts. 9,112
  2. Avatar for Deleted player 62. Deleted player pts. 9,103
  3. Avatar for multaq 63. multaq Lv 1 10 pts. 9,095
  4. Avatar for Azukay 64. Azukay Lv 1 10 pts. 9,083
  5. Avatar for senor pit 65. senor pit Lv 1 9 pts. 9,078
  6. Avatar for georg137 66. georg137 Lv 1 9 pts. 9,074
  7. Avatar for manu8170 67. manu8170 Lv 1 8 pts. 9,062
  8. Avatar for andrewtmaxwell 68. andrewtmaxwell Lv 1 8 pts. 9,052
  9. Avatar for TastyMunchies 69. TastyMunchies Lv 1 8 pts. 9,039
  10. Avatar for alcor29 70. alcor29 Lv 1 7 pts. 9,013

Comments