Placeholder image of a protein
Icon representing a puzzle

1452: Unsolved De-novo Freestyle 121

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
November 21, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIEIRFTNMRREEVQKELEKFKERLKELEKRTGSEIRIEIEERDGEVRVEVEIRNSHEEEVRQIIEEIERWVRKMGGELRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,979
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,897
  3. Avatar for Go Science 3. Go Science 52 pts. 9,821
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 9,803
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 9,756
  6. Avatar for Contenders 6. Contenders 16 pts. 9,712
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,656
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,602
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,461
  10. Avatar for freefolder 10. freefolder 2 pts. 9,121
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,979
  2. Avatar for phi16 2. phi16 Lv 1 81 pts. 9,963
  3. Avatar for lamoille 3. lamoille Lv 1 65 pts. 9,963
  4. Avatar for grogar7 4. grogar7 Lv 1 52 pts. 9,958
  5. Avatar for alcor29 5. alcor29 Lv 1 41 pts. 9,936
  6. Avatar for tokens 6. tokens Lv 1 32 pts. 9,929
  7. Avatar for actiasluna 7. actiasluna Lv 1 24 pts. 9,889
  8. Avatar for Blipperman 8. Blipperman Lv 1 18 pts. 9,887
  9. Avatar for Skippysk8s 9. Skippysk8s Lv 1 14 pts. 9,881
  10. Avatar for andrewxc 10. andrewxc Lv 1 10 pts. 9,876

Comments