1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Summary

• Created: December 03, 2017
• Expires: December 10, 2017 at 23:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

• 11. Russian team 4 pts. 9,619
• 12. Richard Dawkins Foundation 2 pts. 9,400
• 13. freefolder 2 pts. 9,372
• 14. xkcd 1 pt. 9,302
• 15. Alpha Rays 1 pt. 9,146
• 16. Eὕρηκα! Heureka! 1 pt. 9,144
• 17. Italiani Al Lavoro 1 pt. 9,122
• 18. Crunching Family 1 pt. 9,111
• 19. SETI.Germany 1 pt. 9,104
• 20. DSN @ Home 1 pt. 9,021

Top soloists

• 1. LociOiling 100 pts. 10,179
• 2. Bruno Kestemont 97 pts. 10,120
• 3. dcrwheeler 94 pts. 10,118
• 4. Enzyme 91 pts. 10,094
• 5. johnmitch 89 pts. 10,089
• 6. phi16 86 pts. 10,085
• 7. Deleted player pts. 10,075
• 8. Galaxie 80 pts. 10,073
• 9. ZeroLeak7 78 pts. 10,072
• 10. retiredmichael 75 pts. 10,063