1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Summary

• Created: December 03, 2017
• Expires: December 10, 2017 at 23:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

• 1. Beta Folders 100 pts. 10,179
• 2. Go Science 78 pts. 10,120
• 3. Anthropic Dreams 60 pts. 10,098
• 4. Gargleblasters 45 pts. 10,094
• 5. L'Alliance Francophone 33 pts. 10,056
• 6. Contenders 24 pts. 10,003
• 7. Marvin's bunch 17 pts. 9,999
• 8. HMT heritage 12 pts. 9,998
• 9. Void Crushers 8 pts. 9,981
• 10. GENE 433 6 pts. 9,901

Top soloists

• 1. LociOiling 100 pts. 10,179
• 2. Bruno Kestemont 97 pts. 10,120
• 3. dcrwheeler 94 pts. 10,118
• 4. Enzyme 91 pts. 10,094
• 5. johnmitch 89 pts. 10,089
• 6. phi16 86 pts. 10,085
• 7. Deleted player pts. 10,075
• 8. Galaxie 80 pts. 10,073
• 9. ZeroLeak7 78 pts. 10,072
• 10. retiredmichael 75 pts. 10,063