1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Summary

• Created: December 03, 2017
• Expires: December 10, 2017 at 23:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

• 11. Russian team 4 pts. 9,619
• 12. Richard Dawkins Foundation 2 pts. 9,400
• 13. freefolder 2 pts. 9,372
• 14. xkcd 1 pt. 9,302
• 15. Alpha Rays 1 pt. 9,146
• 16. Eὕρηκα! Heureka! 1 pt. 9,144
• 17. Italiani Al Lavoro 1 pt. 9,122
• 18. Crunching Family 1 pt. 9,111
• 19. SETI.Germany 1 pt. 9,104
• 20. DSN @ Home 1 pt. 9,021

Top evolvers

• 1. smilingone 100 pts. 10,174
• 2. LociOiling 80 pts. 10,167
• 3. reefyrob 63 pts. 10,166
• 4. retiredmichael 49 pts. 10,142
• 5. Hollinas 37 pts. 10,120
• 6. Bruno Kestemont 28 pts. 10,114
• 7. toshiue 21 pts. 10,108
• 8. pauldunn 15 pts. 10,107
• 9. Galaxie 11 pts. 10,098
• 10. Anfinsen_slept_here 8 pts. 10,093