Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 8,157

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 10,174
  2. Avatar for LociOiling 2. LociOiling Lv 1 80 pts. 10,167
  3. Avatar for reefyrob 3. reefyrob Lv 1 63 pts. 10,166
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 49 pts. 10,142
  5. Avatar for Hollinas 5. Hollinas Lv 1 37 pts. 10,120
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 28 pts. 10,114
  7. Avatar for toshiue 7. toshiue Lv 1 21 pts. 10,108
  8. Avatar for pauldunn 8. pauldunn Lv 1 15 pts. 10,107
  9. Avatar for Galaxie 9. Galaxie Lv 1 11 pts. 10,098
  10. Avatar for Anfinsen_slept_here 10. Anfinsen_slept_here Lv 1 8 pts. 10,093

Comments