Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 8,157

  1. Avatar for mitarcher 91. mitarcher Lv 1 2 pts. 9,408
  2. Avatar for nathanmills 92. nathanmills Lv 1 2 pts. 9,400
  3. Avatar for benrh 93. benrh Lv 1 2 pts. 9,389
  4. Avatar for Altercomp 94. Altercomp Lv 1 2 pts. 9,372
  5. Avatar for khendarg 95. khendarg Lv 1 2 pts. 9,372
  6. Avatar for Scopper 96. Scopper Lv 1 2 pts. 9,361
  7. Avatar for abiogenesis 97. abiogenesis Lv 1 2 pts. 9,358
  8. Avatar for pandapharmd 98. pandapharmd Lv 1 1 pt. 9,340
  9. Avatar for jermainiac 99. jermainiac Lv 1 1 pt. 9,324
  10. Avatar for rabamino12358 100. rabamino12358 Lv 1 1 pt. 9,322

Comments