Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 8,157

  1. Avatar for TheStaticSloth 101. TheStaticSloth Lv 1 1 pt. 9,317
  2. Avatar for fryguy 102. fryguy Lv 1 1 pt. 9,302
  3. Avatar for Arne Heessels 103. Arne Heessels Lv 1 1 pt. 9,284
  4. Avatar for roman madala 104. roman madala Lv 1 1 pt. 9,272
  5. Avatar for micheldeweerd 105. micheldeweerd Lv 1 1 pt. 9,255
  6. Avatar for xabxs 106. xabxs Lv 1 1 pt. 9,235
  7. Avatar for tarimo 107. tarimo Lv 1 1 pt. 9,217
  8. Avatar for pizpot 108. pizpot Lv 1 1 pt. 9,208
  9. Avatar for Auntecedent 109. Auntecedent Lv 1 1 pt. 9,200
  10. Avatar for minhonglee.phd 110. minhonglee.phd Lv 1 1 pt. 9,190

Comments