Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 8,157
  1. Avatar for TheStaticSloth 101. TheStaticSloth Lv 1 1 pt. 9,317
  2. Avatar for fryguy 102. fryguy Lv 1 1 pt. 9,302
  3. Avatar for Arne Heessels 103. Arne Heessels Lv 1 1 pt. 9,284
  4. Avatar for roman madala 104. roman madala Lv 1 1 pt. 9,272
  5. Avatar for micheldeweerd 105. micheldeweerd Lv 1 1 pt. 9,255
  6. Avatar for xabxs 106. xabxs Lv 1 1 pt. 9,235
  7. Avatar for tarimo 107. tarimo Lv 1 1 pt. 9,217
  8. Avatar for pizpot 108. pizpot Lv 1 1 pt. 9,208
  9. Avatar for Auntecedent 109. Auntecedent Lv 1 1 pt. 9,200
  10. Avatar for minhonglee.phd 110. minhonglee.phd Lv 1 1 pt. 9,190

Comments