Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 8,157
  1. Avatar for navn 111. navn Lv 1 1 pt. 9,185
  2. Avatar for pfirth 112. pfirth Lv 1 1 pt. 9,181
  3. Avatar for rinze 113. rinze Lv 1 1 pt. 9,176
  4. Avatar for momadoc 114. momadoc Lv 1 1 pt. 9,174
  5. Avatar for Knoblerine 115. Knoblerine Lv 1 1 pt. 9,158
  6. Avatar for sktbrd341 116. sktbrd341 Lv 1 1 pt. 9,158
  7. Avatar for fishercat 117. fishercat Lv 1 1 pt. 9,153
  8. Avatar for Deleted player 118. Deleted player pts. 9,146
  9. Avatar for maximiliancarey 119. maximiliancarey Lv 1 1 pt. 9,146
  10. Avatar for Savas 120. Savas Lv 1 1 pt. 9,144

Comments