Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 8,157
  1. Avatar for miogatto 121. miogatto Lv 1 1 pt. 9,126
  2. Avatar for snoopydawg7 122. snoopydawg7 Lv 1 1 pt. 9,123
  3. Avatar for darioarena 123. darioarena Lv 1 1 pt. 9,122
  4. Avatar for gstelle 124. gstelle Lv 1 1 pt. 9,119
  5. Avatar for bzipitidoo 125. bzipitidoo Lv 1 1 pt. 9,117
  6. Avatar for centic 126. centic Lv 1 1 pt. 9,111
  7. Avatar for TY2017 127. TY2017 Lv 1 1 pt. 9,109
  8. Avatar for aendgraend 128. aendgraend Lv 1 1 pt. 9,104
  9. Avatar for pruneau_44 129. pruneau_44 Lv 1 1 pt. 9,088
  10. Avatar for Jacksonfly 130. Jacksonfly Lv 1 1 pt. 9,082

Comments