Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 8,157
  1. Avatar for Alistair69 131. Alistair69 Lv 1 1 pt. 9,075
  2. Avatar for Superphosphate 132. Superphosphate Lv 1 1 pt. 9,070
  3. Avatar for 181818 133. 181818 Lv 1 1 pt. 9,040
  4. Avatar for horowsah 134. horowsah Lv 1 1 pt. 9,031
  5. Avatar for aspadistra 135. aspadistra Lv 1 1 pt. 9,021
  6. Avatar for carlitosboy15 136. carlitosboy15 Lv 1 1 pt. 9,003
  7. Avatar for irenagrocka 137. irenagrocka Lv 1 1 pt. 9,002
  8. Avatar for TePie 138. TePie Lv 1 1 pt. 8,988
  9. Avatar for Andy H. 139. Andy H. Lv 1 1 pt. 8,963
  10. Avatar for A_Pickle 140. A_Pickle Lv 1 1 pt. 8,945

Comments