Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 8,157

  1. Avatar for nicobul 11. nicobul Lv 1 73 pts. 10,056
  2. Avatar for reefyrob 12. reefyrob Lv 1 71 pts. 10,045
  3. Avatar for pauldunn 13. pauldunn Lv 1 68 pts. 10,038
  4. Avatar for grogar7 14. grogar7 Lv 1 66 pts. 10,037
  5. Avatar for Azukay 15. Azukay Lv 1 64 pts. 10,019
  6. Avatar for crpainter 16. crpainter Lv 1 62 pts. 10,003
  7. Avatar for frood66 17. frood66 Lv 1 60 pts. 9,999
  8. Avatar for O Seki To 18. O Seki To Lv 1 58 pts. 9,998
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 56 pts. 9,984
  10. Avatar for Timo van der Laan 20. Timo van der Laan Lv 1 54 pts. 9,981

Comments