Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,179
  2. Avatar for Go Science 2. Go Science 78 pts. 10,120
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,098
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,094
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,056
  6. Avatar for Contenders 6. Contenders 24 pts. 10,003
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 9,999
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,998
  9. Avatar for Void Crushers 9. Void Crushers 8 pts. 9,981
  10. Avatar for GENE 433 10. GENE 433 6 pts. 9,901

  1. Avatar for Blipperman 11. Blipperman Lv 1 5 pts. 10,091
  2. Avatar for Skippysk8s 12. Skippysk8s Lv 1 4 pts. 10,091
  3. Avatar for phi16 13. phi16 Lv 1 2 pts. 10,091
  4. Avatar for lamoille 14. lamoille Lv 1 2 pts. 10,090
  5. Avatar for Deleted player 15. Deleted player pts. 10,088
  6. Avatar for Deleted player 16. Deleted player pts. 10,083
  7. Avatar for Maerlyn138 17. Maerlyn138 Lv 1 1 pt. 10,080
  8. Avatar for Azukay 18. Azukay Lv 1 1 pt. 10,074
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 1 pt. 10,021
  10. Avatar for jausmh 20. jausmh Lv 1 1 pt. 9,995

Comments