Placeholder image of a protein
Icon representing a puzzle

1456: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
December 03, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,179
  2. Avatar for Go Science 2. Go Science 78 pts. 10,120
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,098
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,094
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,056
  6. Avatar for Contenders 6. Contenders 24 pts. 10,003
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 9,999
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,998
  9. Avatar for Void Crushers 9. Void Crushers 8 pts. 9,981
  10. Avatar for GENE 433 10. GENE 433 6 pts. 9,901

  1. Avatar for devjosh 151. devjosh Lv 1 1 pt. 8,379
  2. Avatar for itsLiseczeq 152. itsLiseczeq Lv 1 1 pt. 8,338
  3. Avatar for trump2020 153. trump2020 Lv 1 1 pt. 8,259
  4. Avatar for jflat06 154. jflat06 Lv 1 1 pt. 8,157
  5. Avatar for Susume 155. Susume Lv 1 1 pt. 8,149
  6. Avatar for eromana 156. eromana Lv 1 1 pt. 8,148
  7. Avatar for lamoille 157. lamoille Lv 1 1 pt. 8,148
  8. Avatar for Hollinas 158. Hollinas Lv 1 1 pt. 8,148
  9. Avatar for pietzcker 159. pietzcker Lv 1 1 pt. 8,148
  10. Avatar for ikalvet 160. ikalvet Lv 1 1 pt. 8,148

Comments