1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 8 years ago

Summary

• Created: December 12, 2017
• Expires: December 19, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

• 11. Minions of TWIS 3 pts. 9,539
• 12. SETI.Germany 2 pts. 9,504
• 13. Villanova ChE 1 pt. 9,445
• 14. Richard Dawkins Foundation 1 pt. 9,351
• 15. freefolder 1 pt. 9,338
• 16. NE224 F2017 1 pt. 9,283
• 17. DSN @ Home 1 pt. 9,227
• 18. Team South Africa 1 pt. 9,156
• 19. Family Style Folding 1 pt. 9,132
• 20. Rechenkraft.net 1 pt. 9,067

Top soloists

• 1. Bruno Kestemont 100 pts. 10,244
• 2. retiredmichael 98 pts. 10,239
• 3. LociOiling 95 pts. 10,220
• 4. pauldunn 93 pts. 10,204
• 5. frood66 90 pts. 10,202
• 6. grogar7 88 pts. 10,179
• 7. anthion 85 pts. 10,178
• 8. ZeroLeak7 83 pts. 10,174
• 9. Galaxie 80 pts. 10,150
• 10. Skippysk8s 78 pts. 10,127