1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since about 8 years ago

Summary

• Created: December 12, 2017
• Expires: December 19, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

• 1. Beta Folders 100 pts. 10,248
• 2. Go Science 77 pts. 10,247
• 3. Marvin's bunch 58 pts. 10,202
• 4. Anthropic Dreams 43 pts. 10,186
• 5. Gargleblasters 31 pts. 10,178
• 6. Contenders 22 pts. 10,120
• 7. L'Alliance Francophone 15 pts. 10,090
• 8. Void Crushers 11 pts. 10,041
• 9. HMT heritage 7 pts. 10,012
• 10. GENE 433 5 pts. 9,692

Top soloists

• 1. Bruno Kestemont 100 pts. 10,244
• 2. retiredmichael 98 pts. 10,239
• 3. LociOiling 95 pts. 10,220
• 4. pauldunn 93 pts. 10,204
• 5. frood66 90 pts. 10,202
• 6. grogar7 88 pts. 10,179
• 7. anthion 85 pts. 10,178
• 8. ZeroLeak7 83 pts. 10,174
• 9. Galaxie 80 pts. 10,150
• 10. Skippysk8s 78 pts. 10,127