Placeholder image of a protein
Icon representing a puzzle

1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Beta Folders 100 pts. 10,248
  2. Avatar for Go Science 2. Go Science 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,202
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 10,186
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,178
  6. Avatar for Contenders 6. Contenders 22 pts. 10,120
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,090
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 10,041
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,012
  10. Avatar for GENE 433 10. GENE 433 5 pts. 9,692

  1. Avatar for versat82 161. versat82 Lv 1 1 pt. 9,067
  2. Avatar for 181818 162. 181818 Lv 1 1 pt. 9,064
  3. Avatar for jallinvi 163. jallinvi Lv 1 1 pt. 9,015
  4. Avatar for Perhonen 164. Perhonen Lv 1 1 pt. 8,906
  5. Avatar for Ricardo Oliveira 165. Ricardo Oliveira Lv 1 1 pt. 8,837
  6. Avatar for zeynepekacar 166. zeynepekacar Lv 1 1 pt. 8,793
  7. Avatar for 18793663560 167. 18793663560 Lv 1 1 pt. 8,737
  8. Avatar for FJPielage 168. FJPielage Lv 1 1 pt. 8,683
  9. Avatar for Alex Hofgesang 169. Alex Hofgesang Lv 1 1 pt. 8,533
  10. Avatar for 01010011111 170. 01010011111 Lv 1 1 pt. 8,454

Comments