Placeholder image of a protein
Icon representing a puzzle

1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Beta Folders 100 pts. 10,248
  2. Avatar for Go Science 2. Go Science 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,202
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 10,186
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,178
  6. Avatar for Contenders 6. Contenders 22 pts. 10,120
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,090
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 10,041
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,012
  10. Avatar for GENE 433 10. GENE 433 5 pts. 9,692

  1. Avatar for AzukayIRC 181. AzukayIRC Lv 1 1 pt. 8,418
  2. Avatar for jbmkfm125 182. jbmkfm125 Lv 1 1 pt. 8,418
  3. Avatar for eboppterp 183. eboppterp Lv 1 1 pt. 8,418
  4. Avatar for Dreaming 184. Dreaming Lv 1 1 pt. 8,418

Comments