Placeholder image of a protein
Icon representing a puzzle

1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
December 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Beta Folders 100 pts. 10,248
  2. Avatar for Go Science 2. Go Science 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,202
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 10,186
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,178
  6. Avatar for Contenders 6. Contenders 22 pts. 10,120
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,090
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 10,041
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,012
  10. Avatar for GENE 433 10. GENE 433 5 pts. 9,692

  1. Avatar for Tehnologik1 21. Tehnologik1 Lv 1 57 pts. 10,084
  2. Avatar for Blipperman 22. Blipperman Lv 1 55 pts. 10,077
  3. Avatar for smilingone 23. smilingone Lv 1 53 pts. 10,075
  4. Avatar for NinjaGreg 24. NinjaGreg Lv 1 52 pts. 10,072
  5. Avatar for johnmitch 25. johnmitch Lv 1 50 pts. 10,069
  6. Avatar for fiendish_ghoul 26. fiendish_ghoul Lv 1 48 pts. 10,067
  7. Avatar for alcor29 27. alcor29 Lv 1 47 pts. 10,053
  8. Avatar for Timo van der Laan 28. Timo van der Laan Lv 1 46 pts. 10,041
  9. Avatar for SKSbell 29. SKSbell Lv 1 44 pts. 10,034
  10. Avatar for Flagg65a 30. Flagg65a Lv 1 43 pts. 10,030

Comments