Placeholder image of a protein
Icon representing a puzzle

1459: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
December 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Beta Folders 100 pts. 10,248
  2. Avatar for Go Science 2. Go Science 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,202
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 10,186
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,178
  6. Avatar for Contenders 6. Contenders 22 pts. 10,120
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,090
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 10,041
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,012
  10. Avatar for GENE 433 10. GENE 433 5 pts. 9,692

  1. Avatar for YeshuaLives 81. YeshuaLives Lv 1 6 pts. 9,660
  2. Avatar for Deleted player 82. Deleted player pts. 9,650
  3. Avatar for irenagrocka 83. irenagrocka Lv 1 6 pts. 9,639
  4. Avatar for rezaefar 84. rezaefar Lv 1 5 pts. 9,637
  5. Avatar for maribuxi 85. maribuxi Lv 1 5 pts. 9,621
  6. Avatar for SaraL 86. SaraL Lv 1 5 pts. 9,593
  7. Avatar for FrazzleDazzle 87. FrazzleDazzle Lv 1 5 pts. 9,590
  8. Avatar for leehaggis 88. leehaggis Lv 1 4 pts. 9,587
  9. Avatar for rinze 89. rinze Lv 1 4 pts. 9,583
  10. Avatar for ppp6 90. ppp6 Lv 1 4 pts. 9,582

Comments