Placeholder image of a protein
Icon representing a puzzle

1462: Reindeer Beta-lactoglobulin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
December 21, 2017
Expires
Max points
100
Description

This protein is a component of reindeer milk. Beta-lactoglobulin is a protein found in the milk of many mammals, including cows and sheep, but not in humans. Its natural function is still unknown. The structure of this protein was determined (with some difficulty) by x-ray crystallography in 2006. However, parts of the published structure are a little bit problematic. We want to see if Foldit players can fold this protein starting from an extended chain. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Note that, due to the large size of the protein, this puzzle will be active for two weeks.



Sequence:


IIVTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQCRV

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,184
  2. Avatar for Go Science 2. Go Science 81 pts. 10,056
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 10,031
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 50 pts. 9,961
  5. Avatar for Marvin's bunch 5. Marvin's bunch 39 pts. 9,899
  6. Avatar for Void Crushers 6. Void Crushers 30 pts. 9,603
  7. Avatar for Russian team 7. Russian team 23 pts. 9,446
  8. Avatar for Contenders 8. Contenders 17 pts. 9,404
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 12 pts. 9,360
  10. Avatar for Deleted group 10. Deleted group pts. 9,049

  1. Avatar for Vincera 91. Vincera Lv 1 7 pts. 7,571
  2. Avatar for cobaltteal 92. cobaltteal Lv 1 7 pts. 7,556
  3. Avatar for abiogenesis 93. abiogenesis Lv 1 7 pts. 7,536
  4. Avatar for FishKAA 94. FishKAA Lv 1 6 pts. 7,466
  5. Avatar for davidgn 95. davidgn Lv 1 6 pts. 7,443
  6. Avatar for Deleted player 96. Deleted player pts. 7,439
  7. Avatar for froggs554 97. froggs554 Lv 1 6 pts. 7,436
  8. Avatar for mitarcher 98. mitarcher Lv 1 5 pts. 7,415
  9. Avatar for lamoille 99. lamoille Lv 1 5 pts. 7,412
  10. Avatar for boondog 100. boondog Lv 1 5 pts. 7,396

Comments


Susume Lv 1

I am confused about the disulfide bonus on 1462. There are 5 cysteines, at positions 66, 106, 119, 121, and 160. If two or four of these are involved in disulfide bonds, I would expect those two or four to be strongly conserved, that is, there would be cysteines in those spots in many related proteins, and a related protein that has one of the cysteines in a disulfide pair would almost always have the other as well.

Jpred finds 936 homologous sequences (related proteins) for our protein. Of those, 608 have a cys in position 66 - so that cys is strongly conserved. However, none of the others are conserved at anything like the same rate. At positions 106, 119, and 121, respectively, there are only 54, 30, and 6 related proteins that also have a cys there. None of those positions can be providing the selection pressure on position 66 to remain cysteine. 160 is more promising, with 234 related proteins having a cys there, but that's still not close to 608. This makes me wonder if there is some other molecule that residue 66 commonly forms a disulfide bond with, that provides the selection pressure to keep a cys in that spot. The other common AAs at that spot are K, G, Q, S, and N, suggesting that residue 66 is on the surface where it could interact with some other molecule.

Does this line of reasoning make any sense? Is it possible the disulfide is not within our protein but with some other molecule? Do you have some other reason to believe there is a disulfide within our protein?

dbuske Lv 1

I have made a fold just using the rama utility.
I moved the dots to red and green areas into small groups.
running wiggle here and there.
Dots would move to other colors at times which is fine.
Move dots, wiggle move dots, til finished.
I got perfect rama, but not folded up completely.
I doubt this would fold in the lab, but I wanted to
give it a try.

Bletchley Park Lv 1

The puzzle description does not mention at all that there is a 250 point bonus for making a disulfide bond !
I found out by accident…