Placeholder image of a protein
Icon representing a puzzle

1462: Reindeer Beta-lactoglobulin

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
December 21, 2017
Expires
Max points
100
Description

This protein is a component of reindeer milk. Beta-lactoglobulin is a protein found in the milk of many mammals, including cows and sheep, but not in humans. Its natural function is still unknown. The structure of this protein was determined (with some difficulty) by x-ray crystallography in 2006. However, parts of the published structure are a little bit problematic. We want to see if Foldit players can fold this protein starting from an extended chain. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Note that, due to the large size of the protein, this puzzle will be active for two weeks.



Sequence:


IIVTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQCRV

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,184
  2. Avatar for Go Science 2. Go Science 81 pts. 10,056
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 10,031
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 50 pts. 9,961
  5. Avatar for Marvin's bunch 5. Marvin's bunch 39 pts. 9,899
  6. Avatar for Void Crushers 6. Void Crushers 30 pts. 9,603
  7. Avatar for Russian team 7. Russian team 23 pts. 9,446
  8. Avatar for Contenders 8. Contenders 17 pts. 9,404
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 12 pts. 9,360
  10. Avatar for Deleted group 10. Deleted group pts. 9,049
  1. Avatar for tomespen 51. tomespen Lv 1 27 pts. 8,413
  2. Avatar for georg137 52. georg137 Lv 1 26 pts. 8,402
  3. Avatar for stomjoh 53. stomjoh Lv 1 26 pts. 8,372
  4. Avatar for Deleted player 54. Deleted player 25 pts. 8,367
  5. Avatar for Maerlyn138 55. Maerlyn138 Lv 1 24 pts. 8,357
  6. Avatar for SaraL 56. SaraL Lv 1 23 pts. 8,274
  7. Avatar for Flagg65a 57. Flagg65a Lv 1 23 pts. 8,244
  8. Avatar for tarimo 58. tarimo Lv 1 22 pts. 8,229
  9. Avatar for jausmh 59. jausmh Lv 1 21 pts. 8,214
  10. Avatar for Simek 60. Simek Lv 1 21 pts. 8,169

Comments

Hanto Lv 1

The puzzle description does not mention at all that there is a 250 point bonus for making a disulfide bond !
I found out by accident…

dbuske Lv 1

I have made a fold just using the rama utility.
I moved the dots to red and green areas into small groups.
running wiggle here and there.
Dots would move to other colors at times which is fine.
Move dots, wiggle move dots, til finished.
I got perfect rama, but not folded up completely.
I doubt this would fold in the lab, but I wanted to
give it a try.

Bletchley Park Lv 1

The puzzle description does not mention at all that there is a 250 point bonus for making a disulfide bond !
I found out by accident…