Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,913
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,536
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,514
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,456
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 10,430
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,423
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 12 pts. 10,400
  8. Avatar for Contenders 8. Contenders 8 pts. 10,360
  9. Avatar for Deleted group 9. Deleted group pts. 10,038
  10. Avatar for Russian team 10. Russian team 3 pts. 9,890
  1. Avatar for Cagdason 91. Cagdason Lv 1 2 pts. 9,297
  2. Avatar for mitarcher 92. mitarcher Lv 1 2 pts. 9,283
  3. Avatar for Auntecedent 93. Auntecedent Lv 1 2 pts. 9,243
  4. Avatar for Ladybug_dk 94. Ladybug_dk Lv 1 2 pts. 9,242
  5. Avatar for ppp6 95. ppp6 Lv 1 1 pt. 9,240
  6. Avatar for sciencewalker 96. sciencewalker Lv 1 1 pt. 9,220
  7. Avatar for rabamino12358 97. rabamino12358 Lv 1 1 pt. 9,217
  8. Avatar for benrh 98. benrh Lv 1 1 pt. 9,215
  9. Avatar for tela 99. tela Lv 1 1 pt. 9,212
  10. Avatar for toshiue 100. toshiue Lv 1 1 pt. 9,188

Comments