Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Go Science 100 pts. 10,913
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,536
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,514
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,456
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 10,430
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,423
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 12 pts. 10,400
  8. Avatar for Contenders 8. Contenders 8 pts. 10,360
  9. Avatar for Deleted group 9. Deleted group pts. 10,038
  10. Avatar for Russian team 10. Russian team 3 pts. 9,890

  1. Avatar for mrJojo 131. mrJojo Lv 1 1 pt. 8,899
  2. Avatar for Pasava 132. Pasava Lv 1 1 pt. 8,875
  3. Avatar for Vertecedoc 133. Vertecedoc Lv 1 1 pt. 8,869
  4. Avatar for Mike Cassidy 134. Mike Cassidy Lv 1 1 pt. 8,863
  5. Avatar for maribuxi 135. maribuxi Lv 1 1 pt. 8,857
  6. Avatar for doctaven 136. doctaven Lv 1 1 pt. 8,839
  7. Avatar for elcinelif 137. elcinelif Lv 1 1 pt. 8,785
  8. Avatar for mcg666 138. mcg666 Lv 1 1 pt. 8,782
  9. Avatar for molleke 139. molleke Lv 1 1 pt. 8,778
  10. Avatar for bhfreagra 140. bhfreagra Lv 1 1 pt. 8,765

Comments