1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since about 8 years ago

Summary

• Created: January 03, 2018
• Expires: January 10, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

• 1. Go Science 100 pts. 10,913
• 2. Gargleblasters 74 pts. 10,536
• 3. Beta Folders 54 pts. 10,514
• 4. L'Alliance Francophone 38 pts. 10,456
• 5. Marvin's bunch 27 pts. 10,430
• 6. Void Crushers 18 pts. 10,423
• 7. Anthropic Dreams 12 pts. 10,400
• 8. Contenders 8 pts. 10,360
• 9. Deleted group pts. 10,038
• 10. Russian team 3 pts. 9,890

Top soloists

• 11. ZeroLeak7 72 pts. 10,423
• 12. phi16 70 pts. 10,392
• 13. dcrwheeler 67 pts. 10,382
• 14. Skippysk8s 65 pts. 10,375
• 15. tokens 63 pts. 10,375
• 16. Galaxie 61 pts. 10,365
• 17. eusair 58 pts. 10,360
• 18. Bletchley Park 56 pts. 10,360
• 19. pauldunn 54 pts. 10,349
• 20. fiendish_ghoul 53 pts. 10,333