Placeholder image of a protein
Icon representing a puzzle

1465: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Go Science 100 pts. 10,913
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 10,536
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 10,514
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,456
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 10,430
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 10,423
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 12 pts. 10,400
  8. Avatar for Contenders 8. Contenders 8 pts. 10,360
  9. Avatar for Deleted group 9. Deleted group pts. 10,038
  10. Avatar for Russian team 10. Russian team 3 pts. 9,890

  1. Avatar for grogar7 21. grogar7 Lv 1 51 pts. 10,324
  2. Avatar for johnmitch 22. johnmitch Lv 1 49 pts. 10,318
  3. Avatar for guineapig 23. guineapig Lv 1 47 pts. 10,294
  4. Avatar for Enzyme 24. Enzyme Lv 1 45 pts. 10,286
  5. Avatar for caglar 25. caglar Lv 1 44 pts. 10,281
  6. Avatar for hpaege 26. hpaege Lv 1 42 pts. 10,273
  7. Avatar for NinjaGreg 27. NinjaGreg Lv 1 40 pts. 10,266
  8. Avatar for anthion 28. anthion Lv 1 39 pts. 10,248
  9. Avatar for alcor29 29. alcor29 Lv 1 37 pts. 10,236
  10. Avatar for Blipperman 30. Blipperman Lv 1 36 pts. 10,234

Comments