Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,622
  2. Avatar for Russian team 12. Russian team 1 pt. 9,496
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,227
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,136
  5. Avatar for freefolder 15. freefolder 1 pt. 9,096
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,096
  7. Avatar for Deleted group 17. Deleted group pts. 9,066
  8. Avatar for Deleted group 18. Deleted group pts. 8,348
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,795
  2. Avatar for reefyrob 2. reefyrob Lv 1 97 pts. 9,794
  3. Avatar for grogar7 3. grogar7 Lv 1 95 pts. 9,790
  4. Avatar for actiasluna 4. actiasluna Lv 1 92 pts. 9,790
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 89 pts. 9,774
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 86 pts. 9,773
  7. Avatar for nicobul 7. nicobul Lv 1 83 pts. 9,772
  8. Avatar for Galaxie 8. Galaxie Lv 1 81 pts. 9,769
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 78 pts. 9,768
  10. Avatar for ZeroLeak7 10. ZeroLeak7 Lv 1 76 pts. 9,765

Comments