1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Summary

• Created: January 09, 2018
• Expires: January 17, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

• 1. Beta Folders 100 pts. 9,795
• 2. Anthropic Dreams 74 pts. 9,790
• 3. Gargleblasters 54 pts. 9,790
• 4. Go Science 38 pts. 9,774
• 5. L'Alliance Francophone 27 pts. 9,772
• 6. Contenders 18 pts. 9,768
• 7. Void Crushers 12 pts. 9,743
• 8. Marvin's bunch 8 pts. 9,735
• 9. HMT heritage 5 pts. 9,696
• 10. Deleted group pts. 9,689

Top soloists

• 1. LociOiling 100 pts. 9,795
• 2. reefyrob 97 pts. 9,794
• 3. grogar7 95 pts. 9,790
• 4. actiasluna 92 pts. 9,790
• 5. Bruno Kestemont 89 pts. 9,774
• 6. retiredmichael 86 pts. 9,773
• 7. nicobul 83 pts. 9,772
• 8. Galaxie 81 pts. 9,769
• 9. Bletchley Park 78 pts. 9,768
• 10. ZeroLeak7 76 pts. 9,765