1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Summary

• Created: January 09, 2018
• Expires: January 17, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

• 1. Beta Folders 100 pts. 9,795
• 2. Anthropic Dreams 74 pts. 9,790
• 3. Gargleblasters 54 pts. 9,790
• 4. Go Science 38 pts. 9,774
• 5. L'Alliance Francophone 27 pts. 9,772
• 6. Contenders 18 pts. 9,768
• 7. Void Crushers 12 pts. 9,743
• 8. Marvin's bunch 8 pts. 9,735
• 9. HMT heritage 5 pts. 9,696
• 10. Deleted group pts. 9,689

Top evolvers

• 1. LociOiling 100 pts. 9,791
• 2. reefyrob 82 pts. 9,790
• 3. Galaxie 66 pts. 9,789
• 4. actiasluna 53 pts. 9,786
• 5. Deleted player pts. 9,785
• 6. phi16 33 pts. 9,782
• 7. lamoille 26 pts. 9,782
• 8. eromana 20 pts. 9,780
• 9. Blipperman 15 pts. 9,780
• 10. retiredmichael 11 pts. 9,776