Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,795
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,790
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 9,790
  4. Avatar for Go Science 4. Go Science 38 pts. 9,774
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,772
  6. Avatar for Contenders 6. Contenders 18 pts. 9,768
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,743
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,735
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,696
  10. Avatar for Deleted group 10. Deleted group pts. 9,689

  1. Avatar for Enzyme 11. Enzyme Lv 1 73 pts. 9,755
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 71 pts. 9,744
  3. Avatar for Timo van der Laan 13. Timo van der Laan Lv 1 69 pts. 9,743
  4. Avatar for phi16 14. phi16 Lv 1 66 pts. 9,742
  5. Avatar for fpc 15. fpc Lv 1 64 pts. 9,736
  6. Avatar for pauldunn 16. pauldunn Lv 1 62 pts. 9,736
  7. Avatar for Blipperman 17. Blipperman Lv 1 60 pts. 9,735
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 58 pts. 9,733
  9. Avatar for diamonddays 19. diamonddays Lv 1 56 pts. 9,723
  10. Avatar for Deleted player 20. Deleted player pts. 9,722

Comments