Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 3 pts. 8,854
  2. Avatar for GENE 433 12. GENE 433 2 pts. 8,590
  3. Avatar for Wheaton College Biochemistry 13. Wheaton College Biochemistry 1 pt. 8,239
  4. Avatar for Deleted group 14. Deleted group pts. 7,952
  5. Avatar for PM/01/2018 15. PM/01/2018 1 pt. 7,352
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 7,079
  7. Avatar for KNBIBS@MIMUW 17. KNBIBS@MIMUW 1 pt. 6,451
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,253
  9. Avatar for Deleted group 19. Deleted group pts. 6,024
  10. Avatar for HMT heritage 20. HMT heritage 1 pt. 0
  1. Avatar for benrh 91. benrh Lv 1 2 pts. 8,511
  2. Avatar for SKSbell 92. SKSbell Lv 1 2 pts. 8,510
  3. Avatar for Deleted player 93. Deleted player pts. 8,508
  4. Avatar for alwen 94. alwen Lv 1 2 pts. 8,507
  5. Avatar for Vincera 95. Vincera Lv 1 2 pts. 8,504
  6. Avatar for momadoc 96. momadoc Lv 1 2 pts. 8,503
  7. Avatar for hada 97. hada Lv 1 2 pts. 8,464
  8. Avatar for Dijkgraaf 98. Dijkgraaf Lv 1 2 pts. 8,373
  9. Avatar for fpc 99. fpc Lv 1 2 pts. 8,371
  10. Avatar for TY2017 100. TY2017 Lv 1 1 pt. 8,325

Comments