Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023
  1. Avatar for benrh 91. benrh Lv 1 2 pts. 8,511
  2. Avatar for SKSbell 92. SKSbell Lv 1 2 pts. 8,510
  3. Avatar for Deleted player 93. Deleted player pts. 8,508
  4. Avatar for alwen 94. alwen Lv 1 2 pts. 8,507
  5. Avatar for Vincera 95. Vincera Lv 1 2 pts. 8,504
  6. Avatar for momadoc 96. momadoc Lv 1 2 pts. 8,503
  7. Avatar for hada 97. hada Lv 1 2 pts. 8,464
  8. Avatar for Dijkgraaf 98. Dijkgraaf Lv 1 2 pts. 8,373
  9. Avatar for fpc 99. fpc Lv 1 2 pts. 8,371
  10. Avatar for TY2017 100. TY2017 Lv 1 1 pt. 8,325

Comments