Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 3 pts. 8,854
  2. Avatar for GENE 433 12. GENE 433 2 pts. 8,590
  3. Avatar for Wheaton College Biochemistry 13. Wheaton College Biochemistry 1 pt. 8,239
  4. Avatar for Deleted group 14. Deleted group pts. 7,952
  5. Avatar for PM/01/2018 15. PM/01/2018 1 pt. 7,352
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 7,079
  7. Avatar for KNBIBS@MIMUW 17. KNBIBS@MIMUW 1 pt. 6,451
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,253
  9. Avatar for Deleted group 19. Deleted group pts. 6,024
  10. Avatar for HMT heritage 20. HMT heritage 1 pt. 0
  1. Avatar for Mengee 121. Mengee Lv 1 1 pt. 7,469
  2. Avatar for demeter900 122. demeter900 Lv 1 1 pt. 7,445
  3. Avatar for pjanek 123. pjanek Lv 1 1 pt. 7,431
  4. Avatar for PM_KSienkiewicz 124. PM_KSienkiewicz Lv 1 1 pt. 7,352
  5. Avatar for antibot215 125. antibot215 Lv 1 1 pt. 7,324
  6. Avatar for emtonsti 126. emtonsti Lv 1 1 pt. 7,313
  7. Avatar for 181818 127. 181818 Lv 1 1 pt. 7,252
  8. Avatar for alyssa_d 128. alyssa_d Lv 1 1 pt. 7,079
  9. Avatar for Perhonen 129. Perhonen Lv 1 1 pt. 7,013
  10. Avatar for gstelle 130. gstelle Lv 1 1 pt. 6,751

Comments