Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023

  1. Avatar for Mengee 121. Mengee Lv 1 1 pt. 7,469
  2. Avatar for demeter900 122. demeter900 Lv 1 1 pt. 7,445
  3. Avatar for pjanek 123. pjanek Lv 1 1 pt. 7,431
  4. Avatar for PM_KSienkiewicz 124. PM_KSienkiewicz Lv 1 1 pt. 7,352
  5. Avatar for antibot215 125. antibot215 Lv 1 1 pt. 7,324
  6. Avatar for emtonsti 126. emtonsti Lv 1 1 pt. 7,313
  7. Avatar for 181818 127. 181818 Lv 1 1 pt. 7,252
  8. Avatar for alyssa_d 128. alyssa_d Lv 1 1 pt. 7,079
  9. Avatar for Perhonen 129. Perhonen Lv 1 1 pt. 7,013
  10. Avatar for gstelle 130. gstelle Lv 1 1 pt. 6,751

Comments