Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 3 pts. 8,854
  2. Avatar for GENE 433 12. GENE 433 2 pts. 8,590
  3. Avatar for Wheaton College Biochemistry 13. Wheaton College Biochemistry 1 pt. 8,239
  4. Avatar for Deleted group 14. Deleted group pts. 7,952
  5. Avatar for PM/01/2018 15. PM/01/2018 1 pt. 7,352
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 7,079
  7. Avatar for KNBIBS@MIMUW 17. KNBIBS@MIMUW 1 pt. 6,451
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,253
  9. Avatar for Deleted group 19. Deleted group pts. 6,024
  10. Avatar for HMT heritage 20. HMT heritage 1 pt. 0
  1. Avatar for chiachia 141. chiachia Lv 1 1 pt. 5,835
  2. Avatar for gulsahsimsir 142. gulsahsimsir Lv 1 1 pt. 5,784
  3. Avatar for 01010011111 143. 01010011111 Lv 1 1 pt. 5,767
  4. Avatar for dumpydumpling 144. dumpydumpling Lv 1 1 pt. 5,615
  5. Avatar for PrettyPony200 145. PrettyPony200 Lv 1 1 pt. 5,609
  6. Avatar for Christy H 146. Christy H Lv 1 1 pt. 5,605
  7. Avatar for boboviz 147. boboviz Lv 1 1 pt. 5,562
  8. Avatar for JonnyT 148. JonnyT Lv 1 1 pt. 5,287
  9. Avatar for Ricardo Oliveira 149. Ricardo Oliveira Lv 1 1 pt. 4,967
  10. Avatar for wojto.htc 150. wojto.htc Lv 1 1 pt. 4,484

Comments