Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023
  1. Avatar for chiachia 141. chiachia Lv 1 1 pt. 5,835
  2. Avatar for gulsahsimsir 142. gulsahsimsir Lv 1 1 pt. 5,784
  3. Avatar for 01010011111 143. 01010011111 Lv 1 1 pt. 5,767
  4. Avatar for dumpydumpling 144. dumpydumpling Lv 1 1 pt. 5,615
  5. Avatar for PrettyPony200 145. PrettyPony200 Lv 1 1 pt. 5,609
  6. Avatar for Christy H 146. Christy H Lv 1 1 pt. 5,605
  7. Avatar for boboviz 147. boboviz Lv 1 1 pt. 5,562
  8. Avatar for JonnyT 148. JonnyT Lv 1 1 pt. 5,287
  9. Avatar for Ricardo Oliveira 149. Ricardo Oliveira Lv 1 1 pt. 4,967
  10. Avatar for wojto.htc 150. wojto.htc Lv 1 1 pt. 4,484

Comments