Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 3 pts. 8,854
  2. Avatar for GENE 433 12. GENE 433 2 pts. 8,590
  3. Avatar for Wheaton College Biochemistry 13. Wheaton College Biochemistry 1 pt. 8,239
  4. Avatar for Deleted group 14. Deleted group pts. 7,952
  5. Avatar for PM/01/2018 15. PM/01/2018 1 pt. 7,352
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 7,079
  7. Avatar for KNBIBS@MIMUW 17. KNBIBS@MIMUW 1 pt. 6,451
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,253
  9. Avatar for Deleted group 19. Deleted group pts. 6,024
  10. Avatar for HMT heritage 20. HMT heritage 1 pt. 0
  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 73 pts. 9,364
  2. Avatar for Deleted player 12. Deleted player pts. 9,331
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 69 pts. 9,323
  4. Avatar for LociOiling 14. LociOiling Lv 1 66 pts. 9,313
  5. Avatar for retiredmichael 15. retiredmichael Lv 1 64 pts. 9,305
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 62 pts. 9,299
  7. Avatar for frood66 17. frood66 Lv 1 60 pts. 9,299
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 58 pts. 9,271
  9. Avatar for Deleted player 19. Deleted player pts. 9,270
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 54 pts. 9,267

Comments