Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023
  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 73 pts. 9,364
  2. Avatar for Deleted player 12. Deleted player pts. 9,331
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 69 pts. 9,323
  4. Avatar for LociOiling 14. LociOiling Lv 1 66 pts. 9,313
  5. Avatar for retiredmichael 15. retiredmichael Lv 1 64 pts. 9,305
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 62 pts. 9,299
  7. Avatar for frood66 17. frood66 Lv 1 60 pts. 9,299
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 58 pts. 9,271
  9. Avatar for Deleted player 19. Deleted player pts. 9,270
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 54 pts. 9,267

Comments