Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 3 pts. 8,854
  2. Avatar for GENE 433 12. GENE 433 2 pts. 8,590
  3. Avatar for Wheaton College Biochemistry 13. Wheaton College Biochemistry 1 pt. 8,239
  4. Avatar for Deleted group 14. Deleted group pts. 7,952
  5. Avatar for PM/01/2018 15. PM/01/2018 1 pt. 7,352
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 7,079
  7. Avatar for KNBIBS@MIMUW 17. KNBIBS@MIMUW 1 pt. 6,451
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 6,253
  9. Avatar for Deleted group 19. Deleted group pts. 6,024
  10. Avatar for HMT heritage 20. HMT heritage 1 pt. 0
  1. Avatar for Glen B 61. Glen B Lv 1 11 pts. 8,860
  2. Avatar for versat82 62. versat82 Lv 1 10 pts. 8,854
  3. Avatar for ViJay7019 63. ViJay7019 Lv 1 10 pts. 8,851
  4. Avatar for NotJim99 64. NotJim99 Lv 1 9 pts. 8,842
  5. Avatar for Knoblerine 65. Knoblerine Lv 1 9 pts. 8,816
  6. Avatar for johnmitch 66. johnmitch Lv 1 8 pts. 8,806
  7. Avatar for Amphimixus 67. Amphimixus Lv 1 8 pts. 8,792
  8. Avatar for pfirth 68. pfirth Lv 1 8 pts. 8,788
  9. Avatar for navn 69. navn Lv 1 7 pts. 8,775
  10. Avatar for jausmh 70. jausmh Lv 1 7 pts. 8,769

Comments